PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna09546.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 367aa    MW: 40628.5 Da    PI: 4.8237
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna09546.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.84.5e-121664148
                             TSSS-HHHHHHHHHHH.HHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdav.kqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g WT+eEd  +v  +  + G g+W++++++ g++R++k+ck rw +yl
  mrna09546.1-v1.0-hybrid 16 KGTWTEEEDANIVAHHgSKNGIGNWTSVPKKAGLNRCGKSCKPRWSNYL 64
                             799******98887774466666************************97 PP

2Myb_DNA-binding40.75.5e-1372113346
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               +T++E+el+v++++  G++ W  Ia+ ++ gRt++++k +w++
  mrna09546.1-v1.0-hybrid  72 TFTPQEEELIVRLHATIGSR-WPIIAQQLP-GRTDNDVKTYWNT 113
                              69******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.2981168IPR017930Myb domain
SuperFamilySSF466897.81E-2413111IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-171367IPR009057Homeodomain-like
SMARTSM007178.2E-71566IPR001005SANT/Myb domain
PfamPF002491.7E-101664IPR001005SANT/Myb domain
CDDcd001673.41E-71864No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2068119IPR009057Homeodomain-like
PROSITE profilePS5129414.39169119IPR017930Myb domain
SMARTSM007172.5E-1269117IPR001005SANT/Myb domain
CDDcd001672.58E-972115No hitNo description
PfamPF002491.2E-1172113IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MGRPPACCDK LINVKKGTWT EEEDANIVAH HGSKNGIGNW TSVPKKAGLN RCGKSCKPRW  60
SNYLKADLKP ETFTPQEEEL IVRLHATIGS RWPIIAQQLP GRTDNDVKTY WNTKLKKKLT  120
DMGIDPVTHR PFSQILADYG NISGLPKSGM RIAIGGSLNK DLKNAMLMKS PEAYTSGLSN  180
FNNSHLVSTT KIEQMQATSS TNFDYYQPYD LLTQLQAMKY VTEVSNSTTN TNPAPSPFNF  240
YSECSLSSSS SSTCSSAAVQ EKSPLAFGWS DFLLEEAFVP TEDARQGEIC WDVQATMQND  300
TAESSSKNMF NQAQTENEGT IYGMSSNQVE ATADPCESSF VEAMVAKDND LFLEFPELLL  360
EEPFYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-22161197108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301300.10.0PREDICTED: myb-related protein 315
TrEMBLM5WT281e-141M5WT28_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s07900.11e-106(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.13e-62MYB family protein